PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.090310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 328aa    MW: 37051.3 Da    PI: 7.8282
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.090310.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++ +G g+W+++++  g+ R++k+c++rw +yl
   Cucsa.090310.1 14 KGLWSPEEDEKLHNYITIHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.41.9e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++++  lG++ W+ Ia+ ++ gRt++++k+ w++
   Cucsa.090310.1  67 RGPFSQQEEDLIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.38961IPR017930Myb domain
SuperFamilySSF466891.5E-2912108IPR009057Homeodomain-like
SMARTSM007173.8E-121363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
CDDcd001671.35E-101761No hitNo description
PROSITE profilePS5129424.962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2665117IPR009057Homeodomain-like
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
PfamPF002493.2E-1367110IPR001005SANT/Myb domain
CDDcd001671.44E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLHNYIT IHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGPF SQQEEDLIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLKQKG  120
IDPNTHKPLI EKEIINNSDN NDNIIITSDD KKSHEKTFPI EEVVPPTNST TTTTTRKSIE  180
SCFDMSTTTT STTSCNFSNF HQLNDGSSHM DLSIIQNNNT NNASTPFEAA ISNLFFPSPN  240
SCGVAHVRPS INLIPSENNP SSTVSSTSEV VAHNNNNNNN GFLWHSDDQF LQTASILMRN  300
DWHHHQINHR HTTLQAEILG QPTFPKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818470.0LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144800.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH64e-87MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0A0LGL11e-168A0A0A0LGL1_CUCSA; Uncharacterized protein
STRINGGLYMA03G38660.12e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.19e-85myb domain protein 86